DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4872 and AT5G52810

DIOPT Version :9

Sequence 1:NP_573173.2 Gene:CG4872 / 32676 FlyBaseID:FBgn0030799 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_200093.1 Gene:AT5G52810 / 835358 AraportID:AT5G52810 Length:325 Species:Arabidopsis thaliana


Alignment Length:382 Identity:95/382 - (24%)
Similarity:155/382 - (40%) Gaps:94/382 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSTPAYYNADAVRQVLTW-PLVN------KAVESALVAIVKQNPETPSTSFAFQPKRTFIPCGKE 60
            ::.|.:..|::...:|:. .|:|      ....|.:.:.|:||....|.|               
plant     2 AALPVFIPAESFPSILSHETLINHFRTNLPKHSSTITSPVRQNYTVSSPS--------------- 51

  Fly    61 PGKVLLTMPAYVGNYRLESSRDPGEVEHTHSTLACKLVTSFSGNPRRDPPLPSIHAHVLLFDNQT 125
               .||.||::..:..|             ..:..||||.|..|..::  ||.||....||.:.|
plant    52 ---SLLLMPSWSSSSSL-------------PYMGVKLVTYFPHNSSQN--LPGIHGSYTLFSSTT 98

  Fly   126 GQLSAIMEGTDLTTWRTVSASLVATKYLYFRRFGAQAEQERNINVAIVGCGVQGQLHAAAFCANF 190
            ||..|.|:||.||.:||.|.|.:.:|.|        |..:..:.:.:....:...|..:...|..
plant    99 GQTLATMDGTVLTLYRTSSVSGLGSKIL--------ARDDSQVLIMVGSGALAPHLIKSHLAAKP 155

  Fly   191 RVRQLNLYNRTQAKALGLADQL-----RQKLNTESGTQITVCPSPHEACQD----ADIICIATYS 246
            .:|::.::|||..:|..||:.|     .::::.:|          |::...    .|||..||.|
plant   156 SLRRVIIWNRTPQRAQELAETLSKDPQHKEISFDS----------HDSLDQIIPLGDIISCATNS 210

  Fly   247 KEPLIQLADLKSKRAVHINAVGAGEVHFSEVAPKIYQQAKVYVD-CYANAEA-ELVGLPAPITAE 309
            ..||::...||.  ..|::.||:......|......|:..|:|| ..|..|| ||.|     ..|
plant   211 TVPLVKGEFLKP--GTHLDLVGSFSHEMKECDDNAIQRGSVFVDNDTAMIEAGELAG-----AFE 268

  Fly   310 VGQI-----------ILDGNYPKE-----LEISIFQSMGMASEDACVAQAVQDCIIS 350
            .|.|           ::.|:  ||     .:|::|:|:|..:.|...||.|.:..:|
plant   269 RGVIKREDICGNLVELIKGD--KEGRKSSTDITVFKSVGSGTVDLLTAQLVHETYLS 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4872NP_573173.2 NADB_Rossmann 5..298 CDD:304358 77/310 (25%)
OCDMu 8..344 CDD:225280 92/369 (25%)
AT5G52810NP_200093.1 OCD_Mu_crystall 7..324 CDD:332249 94/377 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I3535
eggNOG 1 0.900 - - E1_COG2423
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1424
Inparanoid 1 1.050 69 1.000 Inparanoid score I2481
OMA 1 1.010 - - QHG60929
OrthoDB 1 1.010 - - D1345495at2759
OrthoFinder 1 1.000 - - FOG0006383
OrthoInspector 1 1.000 - - oto3877
orthoMCL 1 0.900 - - OOG6_102950
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.740

Return to query results.
Submit another query.