DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4872 and CRYM

DIOPT Version :9

Sequence 1:NP_573173.2 Gene:CG4872 / 32676 FlyBaseID:FBgn0030799 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001363185.1 Gene:CRYM / 1428 HGNCID:2418 Length:314 Species:Homo sapiens


Alignment Length:351 Identity:115/351 - (32%)
Similarity:165/351 - (47%) Gaps:51/351 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSTPAYYNADAVRQVL-TWPLVNKAVESALVAIVKQNPETPSTSFAFQPKRTFIPCGKEPGKVLL 66
            |..||:.:|..|.:.| :..|:...:|:|| |.....||    ....||.||.:|..|..| .|.
Human     2 SRVPAFLSAAEVEEHLRSSSLLIPPLETAL-ANFSSGPE----GGVMQPVRTVVPVTKHRG-YLG 60

  Fly    67 TMPAYVGNYRLESSRDPGEVEHTHSTLACKLVTSFSGNPRRDPPLPSIHAHVLLFDNQTGQLSAI 131
            .||||      .::.|         .|..|||| |..:......:||..|.||||:...|.|.|:
Human    61 VMPAY------SAAED---------ALTTKLVT-FYEDRGITSVVPSHQATVLLFEPSNGTLLAV 109

  Fly   132 MEGTDLTTWRTVSASLVATKYLYFRRFGAQAEQERNINVAIVGCGVQGQLHAAAFCANFRVRQLN 196
            |:|..:|..||.:.|.:|||:|         :...:..:.|:|.|||...|...|...|..:::.
Human   110 MDGNVITAKRTAAVSAIATKFL---------KPPSSEVLCILGAGVQAYSHYEIFTEQFSFKEVR 165

  Fly   197 LYNRTQAKALGLADQLRQKLNTESGTQITVCPSPHEACQDADIICIATYSKEPLIQLADLKSKRA 261
            ::|||:..|...||       |..| ::.||.|..||...||:|...|.:.||:  |.....|..
Human   166 IWNRTKENAEKFAD-------TVQG-EVRVCSSVQEAVAGADVIITVTLATEPI--LFGEWVKPG 220

  Fly   262 VHINAVGAGEVHFSEVAPKIYQQAKVYVDCYANAEAE-----LVGLPAPITAEVGQIILDGNYPK 321
            .|||||||....:.|:..::.::|.:|||....|..|     |.|  |.|.||:|::| .|..|.
Human   221 AHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSG--AEIFAELGEVI-KGVKPA 282

  Fly   322 ELE-ISIFQSMGMASEDACVAQAVQD 346
            ..| .::|:|:|||.||...|:.:.|
Human   283 HCEKTTVFKSLGMAVEDTVAAKLIYD 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4872NP_573173.2 NADB_Rossmann 5..298 CDD:304358 93/293 (32%)
OCDMu 8..344 CDD:225280 111/342 (32%)
CRYMNP_001363185.1 OCD_Mu_crystall 4..314 CDD:367079 114/349 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154136
Domainoid 1 1.000 108 1.000 Domainoid score I6477
eggNOG 1 0.900 - - E1_COG2423
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1424
Inparanoid 1 1.050 117 1.000 Inparanoid score I4813
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60929
OrthoDB 1 1.010 - - D1345495at2759
OrthoFinder 1 1.000 - - FOG0006383
OrthoInspector 1 1.000 - - oto90166
orthoMCL 1 0.900 - - OOG6_102950
Panther 1 1.100 - - LDO PTHR13812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.810

Return to query results.
Submit another query.