DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4872 and crym

DIOPT Version :9

Sequence 1:NP_573173.2 Gene:CG4872 / 32676 FlyBaseID:FBgn0030799 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001096532.1 Gene:crym / 100125176 XenbaseID:XB-GENE-970817 Length:313 Species:Xenopus tropicalis


Alignment Length:352 Identity:107/352 - (30%)
Similarity:162/352 - (46%) Gaps:47/352 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PAYYNADAVRQVLTWPLVNKAVESALVAIVKQNPETPSTSFAFQPKRTFIPCGKEPGKVLLTMPA 70
            ||:..|..|.:.|.:..:...:|.||:..     .:.|.....||.||.:|..|..| .|..|||
 Frog     5 PAFIGAKVVDKYLDFATLIPLLEKALIHF-----SSGSEGGVVQPIRTIVPVAKYSG-FLGVMPA 63

  Fly    71 YVGNYRLESSRDPGEVEHTHSTLACKLVTSFSGNPRRDPPLPSIHAHVLLFDNQTGQLSAIMEGT 135
            |       |..|        ..|..|:||.:  ..:....:||..|.||||:...|.|.|:::|.
 Frog    64 Y-------SKWD--------DALTTKVVTFY--EKKTSSEIPSHQATVLLFEPSNGTLKAVIDGR 111

  Fly   136 DLTTWRTVSASLVATKYLYFRRFGAQAEQERNINVAIVGCGVQGQLHAAAFCANFRVRQLNLYNR 200
            .:|..||.:.|.:|||.|.    .:.||     .:.|:|.|.|.|.|...|...|..:::.:::|
 Frog   112 VITDKRTAAVSAIATKLLK----PSHAE-----ILCILGSGAQAQSHYQVFTQQFSFKEVRVWSR 167

  Fly   201 TQAKALGLADQLRQKLNTESGTQITVCPSPHEACQDADIICIATYSKEPLIQLADLKSKRAVHIN 265
            |:.||...|       .|..| ::.||.:|.||...||:|...|.:.||:: ..|. .|...|||
 Frog   168 TREKAERFA-------RTAEG-EVHVCSTPQEAVSGADVIITVTMATEPVL-FGDW-VKPGAHIN 222

  Fly   266 AVGAGEVHFSEVAPKIYQQAKVYVD---CYANAEAELVGLPAPITAEVGQIILDGNYPKELE-IS 326
            |:||....:.|:...:.:...:|||   ..|....::|...|.|.||:|: :|.|..|...: .:
 Frog   223 AIGACRPDWRELDDVLMESCVLYVDSKEAAAKESGDIVISKASIFAEIGE-VLKGTKPAVTDKTT 286

  Fly   327 IFQSMGMASEDACVAQAVQDCIISSAK 353
            :|:|:|||.||...|:.|.|..::..|
 Frog   287 VFKSVGMAVEDTVSAKLVYDSWLAENK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4872NP_573173.2 NADB_Rossmann 5..298 CDD:304358 87/294 (30%)
OCDMu 8..344 CDD:225280 102/339 (30%)
crymNP_001096532.1 OCD_Mu_crystall 22..312 CDD:367079 101/332 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I6739
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H1424
Inparanoid 1 1.050 114 1.000 Inparanoid score I4688
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1345495at2759
OrthoFinder 1 1.000 - - FOG0006383
OrthoInspector 1 1.000 - - oto103963
Panther 1 1.100 - - LDO PTHR13812
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.