DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and RGS8

DIOPT Version :10

Sequence 1:NP_523380.2 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_203131.1 Gene:RGS8 / 85397 HGNCID:16810 Length:198 Species:Homo sapiens


Alignment Length:167 Identity:55/167 - (32%)
Similarity:86/167 - (51%) Gaps:17/167 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   471 DYFITSPELPNPWQTDSTEMWDTEKNSKEVPVRRVKRWAFSLRELLNDAIGREQFTKFLEKEYSG 535
            |:....|:.||             :..|.:......|||.|...||:...|...|..||:.|:|.
Human    47 DFTAILPDKPN-------------RALKRLSTEEATRWADSFDVLLSHKYGVAAFRAFLKTEFSE 98

  Fly   536 ENLKFWESVQEM-KALPQSEIKEAIQKIWQEFLAPEAPCPVNVDSKSVELAREAVNSPSGPNRWC 599
            |||:||.:.:|. |....:::.....:|::||:..:||..||:|.::.|..|:.:..||   ..|
Human    99 ENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPREVNIDFQTREATRKNLQEPS---LTC 160

  Fly   600 FDVAASHVYHLMKSDSYSRYLRSDMYKDYLNCSRKKI 636
            ||.|...|:.||:.|||.|:|||.||.|.|:.|::::
Human   161 FDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRL 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_523380.2 DEP_RGS7-like 222..309 CDD:239897
RGS_DHEX 306..407 CDD:375589
GGL 432..493 CDD:128520 4/21 (19%)
RGS_R7-like 504..627 CDD:188660 47/123 (38%)
RGS8NP_203131.1 RGS_RGS8 64..188 CDD:188666 47/126 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.