DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and AXIN1

DIOPT Version :9

Sequence 1:NP_001245722.1 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_011520984.1 Gene:AXIN1 / 8312 HGNCID:903 Length:916 Species:Homo sapiens


Alignment Length:173 Identity:40/173 - (23%)
Similarity:68/173 - (39%) Gaps:49/173 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   482 PWQTDSTEMWDTEKNSKEVPVRRVKRWAFSLRELLNDAIGREQFTKFLEKEYSGENLKFWESVQE 546
            |.::|....::.|.::...|  ...:||.||..||:|..|...|..||::|...:.|.||.:...
Human   110 PRRSDLDLGYEPEGSASPTP
--PYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTG 172

  Fly   547 MKALPQSEIKEAIQKIWQEFLAPEAPCPVNVDSKSVELARE-----------AVNSPSGPN---- 596
            .:.|                    .||..| :.|.::|||.           .|:..:.|.    
Human   173 FRKL--------------------EPCDSN-EEKRLKLARAIYRKYILDNNGIVSRQTKPATKSF 216

  Fly   597 -RWC----------FDVAASHVYHLMKSDSYSRYLRSDMYKDY 628
             :.|          ||.|.:.:...|:.::|..:|:||:|.:|
Human   217 IKGCIMKQLIDPAMFDQAQTEIQATMEENTYPSFLKSDIYLEY 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_001245722.1 DEP_RGS7-like 222..309 CDD:239897
GGL 432..493 CDD:128520 2/10 (20%)
RGS_R7-like 504..627 CDD:188660 35/148 (24%)
AXIN1XP_011520984.1 Axin_TNKS_binding 60..129 CDD:211424 3/18 (17%)
RGS_Axin 138..258 CDD:188662 32/140 (23%)
Axin_b-cat_bind 518..574 CDD:285982
DIX 836..911 CDD:279160
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.