DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and Axin1

DIOPT Version :10

Sequence 1:NP_523380.2 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_063125992.1 Gene:Axin1 / 79257 RGDID:620859 Length:868 Species:Rattus norvegicus


Alignment Length:162 Identity:37/162 - (22%)
Similarity:72/162 - (44%) Gaps:27/162 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   482 PWQTDSTEMWDTEKNSKEVPVRRVKRWAFSLRELLNDAIGREQFTKFLEKEYSGENLKFWESVQE 546
            |.::|....::.|.::...|  ...|||.||..||:|..|...|..||::|...:.|.||.:...
  Rat    66 PRRSDLDLGYEPEGSASPTP--PYLRWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACSG 128

  Fly   547 MKALPQSEIKE-----AIQKIWQEFLAPEAPCPVNVDSKSVELAREAVNSPSGPNRWC------- 599
            .:.|...:..|     ..:.|:::::         :||..: ::|:...:.....:.|       
  Rat   129 FRKLEPCDSNEEKRLKLARAIYRKYI---------LDSNGI-VSRQTKPATKSFIKDCVMKQQID 183

  Fly   600 ---FDVAASHVYHLMKSDSYSRYLRSDMYKDY 628
               ||.|.:.:...|:.::|..:|:||:|.:|
  Rat   184 PAMFDQAQTEIQSTMEENTYPSFLKSDIYLEY 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_523380.2 DEP_RGS7-like 222..309 CDD:239897
RGS_DHEX 306..407 CDD:375589
GGL 432..493 CDD:128520 2/10 (20%)
RGS_R7-like 504..627 CDD:188660 32/137 (23%)
Axin1XP_063125992.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.