DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and Rgs10

DIOPT Version :9

Sequence 1:NP_001245722.1 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_006508202.1 Gene:Rgs10 / 67865 MGIID:1915115 Length:185 Species:Mus musculus


Alignment Length:135 Identity:44/135 - (32%)
Similarity:78/135 - (57%) Gaps:5/135 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   492 DTEKNSKEVPVRRVKRWAFSLRELLNDAIGREQFTKFLEKEYSGENLKFWESVQEMKAL-PQSEI 555
            |...:|....::...:||.||..||.|..|.::|.:||:||:|.||:.||.:.::.|.. .:.::
Mouse    26 DGSSSSGHQSLKSTAKWASSLENLLEDPEGVQRFREFLKKEFSEENVLFWLACEDFKKTEDRKQM 90

  Fly   556 KEAIQKIWQEFLAPEAPCPVNVDSKSVELAREAVNSPSGPNRWCFDVAASHVYHLMKSDSYSRYL 620
            :|..::|:..||:.:|...|||:.:| .|..:.:..   |:...|......:::|||.|||||:|
Mouse    91 QEKAKEIYMTFLSNKASSQVNVEGQS-RLTEKILEE---PHPLMFQKLQDQIFNLMKYDSYSRFL 151

  Fly   621 RSDMY 625
            :||::
Mouse   152 KSDLF 156

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_001245722.1 DEP_RGS7-like 222..309 CDD:239897