DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and RGS2

DIOPT Version :10

Sequence 1:NP_523380.2 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_002914.1 Gene:RGS2 / 5997 HGNCID:9998 Length:211 Species:Homo sapiens


Alignment Length:208 Identity:56/208 - (26%)
Similarity:98/208 - (47%) Gaps:35/208 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   442 RKQKLERRTIKVSKAAEALVAYYDQYNEFDYFITSPELPNPWQTDSTEMWDTEKNSKEVPV---- 502
            :::|::|..:|            |......||:.:...|...:|.        |.||:...    
Human    29 KREKMKRTLLK------------DWKTRLSYFLQNSSTPGKPKTG--------KKSKQQAFIKPS 73

  Fly   503 -RRVKRWAFSLRELLNDAIGREQFTKFLEKEYSGENLKFWESVQEMKAL--PQSEIKEAIQKIWQ 564
             ...:.|:.:..|||....|...|..||:.|:..||::||.:.::.|..  || ::....:||:.
Human    74 PEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQ-KLSSKARKIYT 137

  Fly   565 EFLAPEAPCPVNVDSKSVEL-AREAVNSPSGPNRWCFDVAASHVYHLMKSDSYSRYLRSDMYKDY 628
            :|:..|||..:|:|.::..| |:....:.||    ||..|...||.||:::||.|:|.|:.|:|.
Human   138 DFIEKEAPKEINIDFQTKTLIAQNIQEATSG----CFTTAQKRVYSLMENNSYPRFLESEFYQDL 198

  Fly   629 LNCSRKKIKSIPN 641
              |.:.:|.:.|:
Human   199 --CKKPQITTEPH 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_523380.2 DEP_RGS7-like 222..309 CDD:239897
RGS_DHEX 306..407 CDD:375589
GGL 432..493 CDD:128520 8/50 (16%)
RGS_R7-like 504..627 CDD:188660 41/125 (33%)
RGS2NP_002914.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 14..33 0/3 (0%)
Necessary for membrane association. /evidence=ECO:0000269|PubMed:11278586 32..66 10/53 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..68 5/26 (19%)
Necessary to inhibit protein synthesis. /evidence=ECO:0000269|PubMed:19736320 79..116 13/36 (36%)
RGS_RGS2 84..197 CDD:188664 40/117 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.