DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and Rgs19

DIOPT Version :9

Sequence 1:NP_001245722.1 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_067693.1 Gene:Rgs19 / 59293 RGDID:629471 Length:216 Species:Rattus norvegicus


Alignment Length:180 Identity:51/180 - (28%)
Similarity:81/180 - (45%) Gaps:29/180 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   475 TSPELPNP------------WQTDSTEMWDTEKNSKEVPV-----------RRVKRWAFSLRELL 516
            :.|...||            |..:....|...:.||..|:           ..|:.||.|..:|:
  Rat    31 SGPPSRNPCCLCWCCCCSCSWNQERQRAWQVSRESKLQPLPSCEVCTPPSPEEVQSWAQSFDKLM 95

  Fly   517 NDAIGREQFTKFLEKEYSGENLKFWESVQEMKA-LPQSEIKEAIQKIWQEFLAPEAPCPVNVDSK 580
            :...||..|..||..|||.||:.||.:.:|:|. ..:..:.|..:.|::::::..:|..|::||:
  Rat    96 HSPTGRSVFRAFLRTEYSEENMLFWLACEELKTEADRHVVDEKARLIYEDYVSILSPKEVSLDSR 160

  Fly   581 SVELAREAVN-SPSGPNRWCFDVAASHVYHLMKSDSYSRYLRSDMYKDYL 629
                .||.:| ....|:...||.|...:|.||..|||.|:|.|..|:..|
  Rat   161 ----VREGINRKMQEPSPHTFDDAQLQIYTLMHRDSYPRFLTSPTYRSLL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_001245722.1 DEP_RGS7-like 222..309 CDD:239897
GGL 432..493 CDD:128520 5/29 (17%)
RGS_R7-like 504..627 CDD:188660 42/124 (34%)
Rgs19NP_067693.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
RGS 87..204 CDD:413378 41/120 (34%)
Interaction with GIPC 207..216 51/180 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.