DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and axin1

DIOPT Version :10

Sequence 1:NP_523380.2 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_009297983.1 Gene:axin1 / 57931 ZFINID:ZDB-GENE-000403-1 Length:871 Species:Danio rerio


Alignment Length:198 Identity:45/198 - (22%)
Similarity:84/198 - (42%) Gaps:36/198 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   466 QYNEFDYFITSPELPN------PWQTDSTEMWDTEKNSKEVPVRRVKRWAFSLRELLNDAIGREQ 524
            |||...|...|..|.|      |.:.|....::.|.::...|  ...:||.||..||:|..|...
Zfish    43 QYNHSFYSSKSDSLKNEASIATPRRPDLDLGYEPEGSASPTP--PY
LKWAESLHSLLDDQDGIHL 105

  Fly   525 FTKFLEKEYSGENLKFWESVQEMKALPQSEIKEAIQK----IWQEFLAPEAPCPVNVDSKSVELA 585
            |..||::|...:.|.||.:....:....::..|.:.|    |:::::         :|:..: ::
Zfish   106 FRTFLKQEECADMLDFWFACSGFRKQEANDGNEKMLKLAKAIYKKYI---------LDNNGI-VS 160

  Fly   586 REAVNSPSGPNRWC----------FDVAASHVYHLMKSDSYSRYLRSDMYKDYLNCSRKKIKSIP 640
            |:...:.....:.|          ||.|.:.:..:|:.::|..:|:||:|.:|.....:.    |
Zfish   161 RQIKPATKSFIKDCVMKLHIDPAMFDQAQTEIQTMMEENTYPLFLKSDIYLEYTRTGGES----P 221

  Fly   641 NLF 643
            .||
Zfish   222 KLF 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_523380.2 DEP_RGS7-like 222..309 CDD:239897
RGS_DHEX 306..407 CDD:375589
GGL 432..493 CDD:128520 9/32 (28%)
RGS_R7-like 504..627 CDD:188660 30/136 (22%)
axin1XP_009297983.1 AXIN1_TNKS_BD 12..86 CDD:465215 11/44 (25%)
RGS_Axin 93..212 CDD:188662 27/128 (21%)
Axin_b-cat_bind 470..506 CDD:462616
DIX 791..867 CDD:459936
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.