Sequence 1: | NP_001245722.1 | Gene: | RSG7 / 32674 | FlyBaseID: | FBgn0024941 | Length: | 647 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_954968.1 | Gene: | rgs4 / 569876 | ZFINID: | ZDB-GENE-030131-9839 | Length: | 215 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 55/196 - (28%) |
---|---|---|---|
Similarity: | 97/196 - (49%) | Gaps: | 19/196 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 457 AEALVAYYDQYNEFDYFITSPELPNPWQT--DSTEMWDTEKNSKEVPVRRV-----KRWAFSLRE 514
Fly 515 LLNDAIGREQFTKFLEKEYSGENLKFWESVQEMKALPQSEIKEAIQKIWQEFLAPEAPCPVNVDS 579
Fly 580 KSVELAREAVNSPSGPNRWCFDVAASHVYHLMKSDSYSRYLRSDMY-------KDYLNCS-RKKI 636
Fly 637 K 637 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RSG7 | NP_001245722.1 | DEP_RGS7-like | 222..309 | CDD:239897 | |
GGL | 432..493 | CDD:128520 | 5/37 (14%) | ||
RGS_R7-like | 504..627 | CDD:188660 | 40/134 (30%) | ||
rgs4 | NP_954968.1 | RGS | 71..183 | CDD:295367 | 37/114 (32%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3589 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |