DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and si:ch211-196h16.12

DIOPT Version :9

Sequence 1:NP_001245722.1 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_690503.3 Gene:si:ch211-196h16.12 / 562017 ZFINID:ZDB-GENE-121214-351 Length:238 Species:Danio rerio


Alignment Length:134 Identity:43/134 - (32%)
Similarity:72/134 - (53%) Gaps:10/134 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   489 EMWDTEKNSKEVPVRRVKRWAFSLRELLNDAIGREQFTKFLEKEYSGENLKFWESVQEMKALPQS 553
            |..|..:.::|.|.:       .|..||:..:|.:.|..||..|:|.|||:||.:.:|.|:...:
Zfish   111 EKQDKHRVNEEKPPQ-------DLESLLSSKLGVQAFRWFLRSEFSEENLQFWLACEEYKSSSGA 168

  Fly   554 EIKEAIQKIWQEFLAPEAPCPVNVDSKSVELAREAVNSPSGPNRWCFDVAASHVYHLMKSDSYSR 618
            :.....|.|:::|:.|:||..||:||::.|...:.:..|:...   ||.|...::.||..||:.|
Zfish   169 KRISKAQLIYKQFINPDAPHEVNLDSETREAVMQLMEEPAVDT---FDEAQLRIFTLMAKDSFPR 230

  Fly   619 YLRS 622
            :|||
Zfish   231 FLRS 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_001245722.1 DEP_RGS7-like 222..309 CDD:239897
GGL 432..493 CDD:128520 1/3 (33%)
RGS_R7-like 504..627 CDD:188660 39/119 (33%)
si:ch211-196h16.12XP_690503.3 RGS 126..238 CDD:279009 39/112 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.