DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and Rgs11

DIOPT Version :9

Sequence 1:NP_001245722.1 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_062211.1 Gene:Rgs11 / 54291 RGDID:3563 Length:467 Species:Rattus norvegicus


Alignment Length:454 Identity:158/454 - (34%)
Similarity:241/454 - (53%) Gaps:36/454 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 RGGKNEDAPNILVYKKMEAIIEKMQAESTGVAVRTVKAFMSKVPSVFTGADLVAWILKNFDVEDV 268
            ||......|::   .|||.::..||....||.:|:.:..::.:|....|.|:|.|:::.|.:.: 
  Rat    11 RGCSRMQRPHL---SKMERVVVSMQDPDQGVKMRSQRLLITVIPHAVAGRDIVEWLVQKFCISE- 71

  Fly   269 TEALHFAHLLSSHGYIFPI-DDHALTVKNDGTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQN 332
            .||||...||:.||||:|: :...||::.|.|.|||||||||.|..|.....|||:||.|:.:|.
  Rat    72 EEALHLGTLLTQHGYIYPLRESRDLTLRPDETPYRFQTPYFWTSTLWPAAELDYAIYLAKKNIQK 136

  Fly   333 KTRLELADYEAENLAKLQKMFSRKWEFIFMQAESQSKVAKKRDKLERKVLDSQERAFWDVHRPMP 397
            :.  .|.|||.|:...|.|..:..|:.:.|||..|.:.||:|.|.:|.|:..||:.:|.|::|.|
  Rat   137 QG--ALVDYEKEHYTLLHKKINHAWDLVLMQAREQLRAAKQRRKGDRLVISCQEQTYWLVNKPPP 199

  Fly   398 GCVNTTEIDIKKAYRRGGSSHGTGSAGASLAKNPVEQLTRIIALRKQKLERRTIKVSKAAEALVA 462
            |..|..|    :...||..:.......:...|..:|      ..|| .|.|..:|.|...||.:.
  Rat   200 GAPNVLE----QGPERGSDNPSQVQMSSDFYKCEIE------CFRK-ALSRNRVKSSVCLEAYLK 253

  Fly   463 YYDQYNEFDYFITSPELPNPWQTDSTEMWDTEKNSKEVPVR-RVKRWAFSLRELLNDAIGREQFT 526
            :..|:...|..::.....|||.||....|.....:...|.: ||:||:||.||||:|.:||..|.
  Rat   254 FSSQHGPHDPILSGCLPSNPWITDDVTYWVMNAPNVAAPTKLRVERWSFSFRELLDDPVGRIHFM 318

  Fly   527 KFLEKEYSGENLKFWESVQEMKALPQSEIKEAIQKIWQEFLAPEAPCPVNVDSKSVELAREAVNS 591
            .||:||:|.|||.|||:.:|::...|:::...:..::|:||||.|...:|:||:::|...|.:..
  Rat   319 DFLQKEFSAENLSFWEACEELRFGGQAQVPTLVDSVYQQFLAPGAARWINIDSRTMEWTLEGLRQ 383

  Fly   592 PSGPNRWCFDVAASHVYHLMKSDSYSRYLRSDMYKDYLNCS--------------RKKIKSIPN 641
               |:|:..|.|..|:|.|||.|||.|:|:||:|:..|..:              ||.:.|.|:
  Rat   384 ---PHRYVLDAAQLHIYMLMKKDSYPRFLKSDIYRGLLEEAVIPLETKRWPFPFLRKPLHSSPS 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_001245722.1 DEP_RGS7-like 222..309 CDD:239897 33/87 (38%)
GGL 432..493 CDD:128520 17/60 (28%)
RGS_R7-like 504..627 CDD:188660 55/122 (45%)
Rgs11NP_062211.1 DEP_RGS7-like 26..113 CDD:239897 33/87 (38%)
GGL 224..284 CDD:128520 18/66 (27%)
RGS 295..420 CDD:295367 56/127 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101587
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.