DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and Rgs10

DIOPT Version :10

Sequence 1:NP_523380.2 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_062210.1 Gene:Rgs10 / 54290 RGDID:3562 Length:181 Species:Rattus norvegicus


Alignment Length:135 Identity:45/135 - (33%)
Similarity:78/135 - (57%) Gaps:5/135 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   492 DTEKNSKEVPVRRVKRWAFSLRELLNDAIGREQFTKFLEKEYSGENLKFWESVQEMKAL-PQSEI 555
            |...:|....::...:||.||..||.|..|.::|.:||:||:|.||:.||.:.::.|.. .:.::
  Rat    22 DGSSSSSHQSLKST
AKWASSLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKTEDKKQM 86

  Fly   556 KEAIQKIWQEFLAPEAPCPVNVDSKSVELAREAVNSPSGPNRWCFDVAASHVYHLMKSDSYSRYL 620
            :|..:||:..||:.:|...|||:.:| .|..:.:..   |:...|......:::|||.|||||:|
  Rat    87 QEKAKKIYMTFLSNKASSQVNVEGQS-RLTEKILEE---PHPLMFQKLQDQIFNLMKYDSYSRFL 147

  Fly   621 RSDMY 625
            :||::
  Rat   148 KSDLF 152

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_523380.2 DEP_RGS7-like 222..309 CDD:239897
RGS_DHEX 306..407 CDD:375589