DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and rgs2

DIOPT Version :9

Sequence 1:NP_001245722.1 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001002662.2 Gene:rgs2 / 436935 ZFINID:ZDB-GENE-040718-410 Length:199 Species:Danio rerio


Alignment Length:210 Identity:53/210 - (25%)
Similarity:96/210 - (45%) Gaps:36/210 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   432 VEQLTRIIALRKQKLERRTIKVSKAAEALVAYYDQYNEFD-------------YFITSPELPNPW 483
            :::||::          ||.......|.|:.|.:.....:             :|.|.|      
Zfish     1 MDRLTKM----------RTASPDSGREHLINYRNSEEMTEQSQIKKKSWRPRIFFSTLP------ 49

  Fly   484 QTDSTEMWDTEKNSKEVPVRRVKRWAFSLRELLNDAIGREQFTKFLEKEYSGENLKFWESVQEMK 548
             ...::....:|.|.......|.:||.||..||:...|...|..|::.|...|||.||.:.:|.:
Zfish    50 -LKESQNTSPQKKSHLPTTEEVSQWAQSLDNLLSSKCGLNFFRLFIKSELCEENLDFWLACEEFR 113

  Fly   549 AL-PQSEIKEAIQKIWQEFLAPEAPCPVNVDSKSVELAREAVNSPSGPNRWC-FDVAASHVYHLM 611
            .: .:|::|...:.|:.||:.|::|..:|:|....|:.::::..|:.    | |.||...|.:||
Zfish   114 KIRSRSKLKSKAKSIYNEFIKPDSPKEINLDYNMKEMLQQSLLIPTP----CTFKVAQHRVLYLM 174

  Fly   612 KSDSYSRYLRSDMYK 626
            :.:||.|:|.|::|:
Zfish   175 EHNSYPRFLESELYQ 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_001245722.1 DEP_RGS7-like 222..309 CDD:239897
GGL 432..493 CDD:128520 10/73 (14%)
RGS_R7-like 504..627 CDD:188660 41/125 (33%)
rgs2NP_001002662.2 RGS 77..189 CDD:295367 36/115 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.