DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and rgs20

DIOPT Version :9

Sequence 1:NP_001245722.1 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_005163483.1 Gene:rgs20 / 436704 ZFINID:ZDB-GENE-040718-128 Length:297 Species:Danio rerio


Alignment Length:140 Identity:46/140 - (32%)
Similarity:77/140 - (55%) Gaps:7/140 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   492 DTEKNSKEVPVRRVKRWAFSLRELLNDAIGREQFTKFLEKEYSGENLKFWESVQEM-KALPQSEI 555
            |.|::.|.. ...:..|..|..:|:|...||..|.:||..|:|.||:.||.:.:|. |...:|.|
Zfish   152 DFEESPKPT-AEEICLWGQSFDKLMNCPSGRSAFRQFLRTEFSEENMLFWLACEEFRKEANKSVI 215

  Fly   556 KEAIQKIWQEFLAPEAPCPVNVDSKSVELAREAVN-SPSGPNRWCFDVAASHVYHLMKSDSYSRY 619
            :|..:.|::::::..:|..|::||:    .||.:| :...|....||.|...:|.||:.|||.|:
Zfish   216 EEKARIIYEDYISILSPKEVSLDSR----VREVINRNMLEPTSHTFDDAQLQIYTLMQRDSYPRF 276

  Fly   620 LRSDMYKDYL 629
            :.|.:||:.|
Zfish   277 MNSPVYKNLL 286

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_001245722.1 DEP_RGS7-like 222..309 CDD:239897