DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and Dhit

DIOPT Version :9

Sequence 1:NP_001245722.1 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster


Alignment Length:149 Identity:46/149 - (30%)
Similarity:78/149 - (52%) Gaps:12/149 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   482 PWQTD--STEMWDTEKNSKEVPVRRVKRWAFSLRELLNDAIGREQFTKFLEKEYSGENLKFWESV 544
            |.:.|  :.|..|.|:.:.|    .::.|..|..:|:....||:.|..||..|:|.||:.||.:.
  Fly   115 PTKRDLVNAEFLDGEQPTLE----EIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLAC 175

  Fly   545 QEMKALPQSE-IKEAIQKIWQEFLAPEAPCPVNVDSKSVELAREAVN-SPSGPNRWCFDVAASHV 607
            :::|.....| ::|..:.|::::::..:|..|::||:    .||.|| :...|....||.|...:
  Fly   176 EDLKKENSPELVEEKARLIYEDYISILSPREVSLDSR----VREIVNRNMIEPTTHTFDEAQIQI 236

  Fly   608 YHLMKSDSYSRYLRSDMYK 626
            |.||..|||.|:|.|..:|
  Fly   237 YTLMHRDSYPRFLNSQKFK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_001245722.1 DEP_RGS7-like 222..309 CDD:239897
GGL 432..493 CDD:128520 3/12 (25%)
RGS_R7-like 504..627 CDD:188660 40/125 (32%)
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 40/121 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439814
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.