DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and Grid2ip

DIOPT Version :9

Sequence 1:NP_001245722.1 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_006248928.1 Gene:Grid2ip / 288484 RGDID:1310492 Length:1203 Species:Rattus norvegicus


Alignment Length:253 Identity:51/253 - (20%)
Similarity:82/253 - (32%) Gaps:66/253 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 AIPEPQSATAVVGGGAGGAAPGTATPSPTPLANGSNNGTGSSV-SPAATGTGAVATAASAPA--- 99
            ||.||:|:..:         ...:||.|||.....::...||: ..:....|..|:.:..|.   
  Rat   461 AITEPESSLDL---------EPESTPEPTPEPQPRSSLRASSMCRRSLRSQGLEASLSCGPGDCS 516

  Fly   100 -----------AAGTTSASPPASNPTTASTSTASV-----------VG--AKTAAATTTSSSSAT 140
                       .||..::.|...||...|...|.:           :|  :|:.|:....|...|
  Rat   517 EMPLPLIPGERQAGDGTSLPETPNPKMMSAVYAELESRLNSGFKGKIGTVSKSRASPPVPSLVGT 581

  Fly   141 SSSTAAAGSKQSGS------------SGGLLTVSGNHHHHHHAHPQQSA----AGQSAAQPPQPP 189
            |.....:|....|.            ||||.:.|.:..|.:.:.....|    .|..:..|..||
  Rat   582 SGPRTLSGVSWPGDRLLPSPCYDPLCSGGLASPSSSESHPYASLDSSRAPSPQPGLGSIHPDSPP 646

  Fly   190 TATALAVPSASH---HQRGGKNEDAPNILVYKKMEAIIEKMQAESTGVAVRTVKAFMS 244
            :...:..||...   ..|..::.|....|          .:.:|..|..|..|..|::
  Rat   647 SPDPIRPPSRRKLFAFSRPVRSRDTDRFL----------DVLSEQLGPRVTIVDDFLT 694

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_001245722.1 DEP_RGS7-like 222..309 CDD:239897 5/23 (22%)
GGL 432..493 CDD:128520
RGS_R7-like 504..627 CDD:188660
Grid2ipXP_006248928.1 PDZ_signaling 9..69 CDD:238492
HN_L-delphilin-R1_like 122..201 CDD:259820
PDZ_signaling 269..342 CDD:238492
HN_L-delphilin-R2_like 378..457 CDD:259821
FH2 812..1180 CDD:280362
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.