DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and Rgs13

DIOPT Version :10

Sequence 1:NP_523380.2 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_694811.1 Gene:Rgs13 / 246709 MGIID:2180585 Length:158 Species:Mus musculus


Alignment Length:149 Identity:51/149 - (34%)
Similarity:83/149 - (55%) Gaps:16/149 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   497 SKEVP----VRRVKRWAFSLRELLNDAIGREQFTKFLEKEYSGENLKFWESVQEMK--ALPQSEI 555
            ||.:|    :..|.:||.||..|:....|...:|.:|:.|:|.||:|||.:.:..|  |..:..|
Mouse    16 SKRLPSNLTLDEVLKWAQSLESLMATKYGPIVYTAYLKLEHSDENIKFWMACETYKKIASRRGRI 80

  Fly   556 KEAIQKIWQEFLAPEAPCPVNVDSKSVELAREA-VNSPSGPNRWCFDVAASHVYHLMKSDSYSRY 619
            ..| :|::..::.|::|..:|:||.:    ||| :.|...|.:.||:.|...||..|:.|||.|:
Mouse    81 SRA-KKLYNIYIQPQSPREINIDSTT----REAIIKSIREPTQTCFEEAQKIVYMHMEMDSYPRF 140

  Fly   620 LRSDMYKDYLNCSRKKIKS 638
            |:|:||:..|    |.::|
Mouse   141 LKSEMYQQLL----KTVQS 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_523380.2 DEP_RGS7-like 222..309 CDD:239897
RGS_DHEX 306..407 CDD:375589
GGL 432..493 CDD:128520
RGS_R7-like 504..627 CDD:188660 45/125 (36%)
Rgs13NP_694811.1 RGS 36..148 CDD:470619 40/116 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.