DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and Rgs9

DIOPT Version :9

Sequence 1:NP_001245722.1 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_035398.2 Gene:Rgs9 / 19739 MGIID:1338824 Length:675 Species:Mus musculus


Alignment Length:427 Identity:163/427 - (38%)
Similarity:248/427 - (58%) Gaps:33/427 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 PNILVYKKMEAIIEKMQAESTGVAVRTVKAFMSKVPSVFTGADLVAWILKNFDVEDVTEALHFAH 276
            |.:...:|:||:::.||...|||.:...:..::.||...||.|::.||.:...:.:: ||.:..:
Mouse    12 PRMAFLQKIEALVKDMQNPETGVRMHNQRVLVTSVPHAMTGGDVLQWITQRLWISNL-EAQNLGN 75

  Fly   277 LLSSHGYIFPIDD-HALTVKNDGTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKTRLELAD 340
            .:..:|||:|:.| ..|.:|.|.:.||||||||||:..|..|:||||:||.||.::.|..||  :
Mouse    76 FIVKYGYIYPLQDPKNLILKPDSSLYRFQTPYFWPTQQWPAEDTDYAIYLAKRNIKKKGILE--E 138

  Fly   341 YEAENLAKLQKMFSRKWEFIFMQAESQSKVAKKRDKLERKVLDSQERAFWDVHRPMPGCVNTTEI 405
            ||.||...|.|..:.||:|:.|||:.|.:..|:|:|.:|..||.||:|:|.|||..||..|..:.
Mouse   139 YEKENYDFLNKKINYKWDFVIMQAKEQYRTGKERNKADRYALDCQEKAYWLVHRSPPGMNNVLDY 203

  Fly   406 DIKKAYRRGGSSHGTGSAGASLAKNPVE-QLTRIIALRK------QKLERRTIKVSKAAEALVAY 463
                              |.....||.| :...:.|:||      |.|.|.|:|.|.:...:|.|
Mouse   204 ------------------GLDRVTNPNEVKKQTVTAVRKEIMYYQQALMRSTVKSSVSLGGIVKY 250

  Fly   464 YDQYNEFDYFITSPELPNPWQTDSTEMWDTEKNSKEVPVR-RVKRWAFSLRELLNDAIGREQFTK 527
            .:|::..|..::.....|||.||.|:.||......|:|.: ||:||||:..||:.|..||:.|..
Mouse   251 SEQFSSNDAIMSGCLPSNPWITDDTQFWDLNAKLVEIPTKMRVERWAFNFSELIRDPKGRQSFQY 315

  Fly   528 FLEKEYSGENLKFWESVQEMKALPQSEIKEAIQKIWQEFLAPEAPCPVNVDSKSVELAREAVNSP 592
            ||:||:|||||.|||:.:::|...||::||..::|::.||||.|...:|:|.|::::   .|...
Mouse   316 FLKKEFSGENLGFWEACEDLKYGDQSKVKEKAEEIYKLFLAPGARRWINIDGKTMDI---TVKGL 377

  Fly   593 SGPNRWCFDVAASHVYHLMKSDSYSRYLRSDMYKDYL 629
            ..|:|:..|.|.:|:|.|||.|||:|||:|.:||:.|
Mouse   378 RHPHRYVLDAAQTHIYMLMKKDSYARYLKSPIYKEML 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_001245722.1 DEP_RGS7-like 222..309 CDD:239897 30/87 (34%)
GGL 432..493 CDD:128520 21/67 (31%)
RGS_R7-like 504..627 CDD:188660 56/122 (46%)
Rgs9NP_035398.2 DEP_RGS7-like 22..109 CDD:239897 30/87 (34%)
GGL 219..280 CDD:128520 20/60 (33%)
RGS_RGS9 292..412 CDD:188693 56/122 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 524..571
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 637..662
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D201579at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101587
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.