DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and Rgs4

DIOPT Version :9

Sequence 1:NP_001245722.1 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_033088.2 Gene:Rgs4 / 19736 MGIID:108409 Length:205 Species:Mus musculus


Alignment Length:164 Identity:59/164 - (35%)
Similarity:87/164 - (53%) Gaps:13/164 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 QTDSTEMWDT-EKNSKEVPVRR-----VKRWAFSLRELLNDAIGREQFTKFLEKEYSGENLKFWE 542
            ::||.|...: .|..|.|..:|     ||:||.||..|::...|...|..||:.|||.||:.||.
Mouse    29 KSDSCEHSSSHSKKDKVVTCQRVSQEEVKKWAESLENLIHHECGLAAFKAFLKSEYSEENIDFWI 93

  Fly   543 SVQEMKALPQ-SEIKEAIQKIWQEFLAPEAPCPVNVDSKSVELAREAVNSPSGPNRWCFDVAASH 606
            |.:|.|.:.. |::....:||:.||::.:|...||:||.:.|   |...:...|...|||.|...
Mouse    94 SCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTRE---ETSRNMLQPTITCFDEAQKK 155

  Fly   607 VYHLMKSDSYSRYLRSDMYKDYLN---CSRKKIK 637
            :::||:.|||.|:|:|..|.|..|   |..:|.|
Mouse   156 IFNLMEKDSYRRFLKSRFYLDLTNPSSCGAEKQK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_001245722.1 DEP_RGS7-like 222..309 CDD:239897
GGL 432..493 CDD:128520 3/8 (38%)
RGS_R7-like 504..627 CDD:188660 48/128 (38%)
Rgs4NP_033088.2 RGS_RGS4 63..176 CDD:188669 42/115 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.