Sequence 1: | NP_001245722.1 | Gene: | RSG7 / 32674 | FlyBaseID: | FBgn0024941 | Length: | 647 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_033087.2 | Gene: | Rgs2 / 19735 | MGIID: | 1098271 | Length: | 211 | Species: | Mus musculus |
Alignment Length: | 205 | Identity: | 59/205 - (28%) |
---|---|---|---|
Similarity: | 100/205 - (48%) | Gaps: | 29/205 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 442 RKQKLERRTIKVSKAAEALVAYYDQYNEFDYFITSPELPNPWQTDSTEMWDT-EKNSKEVPVRRV 505
Fly 506 KRWAFSLRELLNDAIGREQFTKFLEKEYSGENLKFWESVQEMKAL--PQSEIKEAIQKIWQEFLA 568
Fly 569 PEAPCPVNVD--SKSVELAREAVNSPSGPNRWCFDVAASHVYHLMKSDSYSRYLRSDMYKDYLNC 631
Fly 632 SRKKIKSIPN 641 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RSG7 | NP_001245722.1 | DEP_RGS7-like | 222..309 | CDD:239897 | |
GGL | 432..493 | CDD:128520 | 8/50 (16%) | ||
RGS_R7-like | 504..627 | CDD:188660 | 43/126 (34%) | ||
Rgs2 | NP_033087.2 | Necessary for membrane association. /evidence=ECO:0000250|UniProtKB:P41220 | 32..66 | 8/45 (18%) | |
Necessary to inhibit protein synthesis. /evidence=ECO:0000250|UniProtKB:P41220 | 79..116 | 14/36 (39%) | |||
RGS_RGS2 | 84..197 | CDD:188664 | 41/118 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3589 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |