DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and Rgs2

DIOPT Version :9

Sequence 1:NP_001245722.1 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_033087.2 Gene:Rgs2 / 19735 MGIID:1098271 Length:211 Species:Mus musculus


Alignment Length:205 Identity:59/205 - (28%)
Similarity:100/205 - (48%) Gaps:29/205 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   442 RKQKLERRTIKVSKAAEALVAYYDQYNEFDYFITSPELPNPWQTDSTEMWDT-EKNSKEVPVRRV 505
            :::|::|..:|            |......||:.:...|...:|.......| .|.|.|    ..
Mouse    29 KREKMKRTLLK------------DWKTRLSYFLQNSSAPGKPKTGKKSKQQTFIKPSPE----EA 77

  Fly   506 KRWAFSLRELLNDAIGREQFTKFLEKEYSGENLKFWESVQEMKAL--PQSEIKEAIQKIWQEFLA 568
            :.||.:..|||....|...|..||:.|:..||::||.:.::.|..  || ::....:||:.:|:.
Mouse    78 QLWAEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQ-KLSSKARKIYTDFIE 141

  Fly   569 PEAPCPVNVD--SKSVELAREAVNSPSGPNRWCFDVAASHVYHLMKSDSYSRYLRSDMYKDYLNC 631
            .|||..:|:|  :||: :|:....:.||    ||..|...||.||:::||.|:|.|:.|:|.  |
Mouse   142 KEAPKEINIDFQTKSL-IAQNIQEATSG----CFTTAQKRVYSLMENNSYPRFLESEFYQDL--C 199

  Fly   632 SRKKIKSIPN 641
            .:.:|.:.|:
Mouse   200 KKPQITTEPH 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_001245722.1 DEP_RGS7-like 222..309 CDD:239897
GGL 432..493 CDD:128520 8/50 (16%)
RGS_R7-like 504..627 CDD:188660 43/126 (34%)
Rgs2NP_033087.2 Necessary for membrane association. /evidence=ECO:0000250|UniProtKB:P41220 32..66 8/45 (18%)
Necessary to inhibit protein synthesis. /evidence=ECO:0000250|UniProtKB:P41220 79..116 14/36 (39%)
RGS_RGS2 84..197 CDD:188664 41/118 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.