DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and rgs-8.2

DIOPT Version :9

Sequence 1:NP_001245722.1 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_508356.1 Gene:rgs-8.2 / 190409 WormBaseID:WBGene00021988 Length:229 Species:Caenorhabditis elegans


Alignment Length:172 Identity:36/172 - (20%)
Similarity:72/172 - (41%) Gaps:22/172 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   472 YFITSPELPNPWQTDSTEMWDTEKNSKEVPVRR---------VKRWAFSLRELLNDAIGREQFTK 527
            ||||...:.....| .|.:.|..|:...: .||         |..|..|...|.....|.:.|.:
 Worm    56 YFITVRNIRKNRNT-ITRIRDALKSPVSI-FRRSPKLSLQEDVLSWQKSPESLAASEYGSKLFVQ 118

  Fly   528 FLEKEYSGENLKFWESVQEMK--ALPQSEIKEAIQKIWQEFLAPEAPCPVNVDSKSVELARE--A 588
            ||:::.|.:::.||.:..:.:  .:.:...:.|...|:..::.  ..|     .:.::|..:  .
 Worm   119 FLKQQTSADDVDFWLACAKHRWTEMTRDGYEYAAYMIYNTYVF--WTC-----ERKIDLLDKFCF 176

  Fly   589 VNSPSGPNRWCFDVAASHVYHLMKSDSYSRYLRSDMYKDYLN 630
            |:...|..|..|..|.::|......||:.::|:..:|.::|:
 Worm   177 VDDDGGTPRDVFITAQAYVGTKFPKDSHKKFLQDPIYLNFLH 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_001245722.1 DEP_RGS7-like 222..309 CDD:239897
GGL 432..493 CDD:128520 6/20 (30%)
RGS_R7-like 504..627 CDD:188660 26/135 (19%)
rgs-8.2NP_508356.1 RGS 102..216 CDD:214613 23/120 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.