Sequence 1: | NP_001245722.1 | Gene: | RSG7 / 32674 | FlyBaseID: | FBgn0024941 | Length: | 647 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_510482.1 | Gene: | rgs-10 / 185764 | WormBaseID: | WBGene00004353 | Length: | 270 | Species: | Caenorhabditis elegans |
Alignment Length: | 207 | Identity: | 48/207 - (23%) |
---|---|---|---|
Similarity: | 81/207 - (39%) | Gaps: | 48/207 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 429 KNPVEQLTRIIALRKQKLERRTIKVSKAAEALVAYYDQYNEFDYFITSPELPNPWQTDSTEMWDT 493
Fly 494 EKNSKEVPVRRVKRWAFSLRELLNDAIGREQFTKFLEKEYSGENLKFWESVQEMKALPQSEIKEA 558
Fly 559 IQKIWQEFLAPEAPCPVNVDSKSVELAR--------EAVNSPSGPNRWCFDVAASHVYHLMKSDS 615
Fly 616 YSRYLRSDMYKD 627 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RSG7 | NP_001245722.1 | DEP_RGS7-like | 222..309 | CDD:239897 | |
GGL | 432..493 | CDD:128520 | 13/60 (22%) | ||
RGS_R7-like | 504..627 | CDD:188660 | 32/130 (25%) | ||
rgs-10 | NP_510482.1 | RGS | 135..251 | CDD:279009 | 30/125 (24%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3589 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |