DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and rgs-2

DIOPT Version :9

Sequence 1:NP_001245722.1 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001379248.1 Gene:rgs-2 / 181414 WormBaseID:WBGene00004345 Length:181 Species:Caenorhabditis elegans


Alignment Length:141 Identity:48/141 - (34%)
Similarity:82/141 - (58%) Gaps:17/141 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   508 WAFSLRELLNDAIGREQFTKFLEKEYSGENLKFWESVQEMKALPQSE-IKEAIQKIWQEFLAPEA 571
            |:.|...|:....|::.|.:||:.|||.||:.||::.:|:|....:| |:|..:.|:::|::..:
 Worm    52 WSQSFENLMKHRAGQKYFAEFLKGEYSDENILFWQACEELKREKNAEKIEEKARIIYEDFISILS 116

  Fly   572 PCPVNVDSKSVELAREAVNSPSG-PNRWCFDVAASHVYHLMKSDSYSRYLRSDMYKDYLNCSRKK 635
            |..|::||:    .||.||:..| |:...||.|.:.:|.||:.|||.|:|.|::|          
 Worm   117 PKEVSLDSR----VREIVNTNMGRPSASTFDEAQNQIYTLMQRDSYPRFLASNIY---------- 167

  Fly   636 IKSIPNLFGVK 646
             |::...||:|
 Worm   168 -KTVMGTFGIK 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_001245722.1 DEP_RGS7-like 222..309 CDD:239897
GGL 432..493 CDD:128520
RGS_R7-like 504..627 CDD:188660 44/120 (37%)
rgs-2NP_001379248.1 RGS 52..169 CDD:413378 44/131 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.