DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and rgs-9

DIOPT Version :10

Sequence 1:NP_523380.2 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_508350.1 Gene:rgs-9 / 180506 WormBaseID:WBGene00004352 Length:235 Species:Caenorhabditis elegans


Alignment Length:141 Identity:34/141 - (24%)
Similarity:61/141 - (43%) Gaps:12/141 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   495 KNSKEVPVRR-VKRWAFSLREL-LNDAIGREQFTKFLEKEYSGENLKFWESVQE---MKALPQSE 554
            :.|.|:.:|. :..|..|...| .::..|.:...:||:::.|.:.:.||....|   .:..|..:
 Worm    89 RRSPEISLREDILSWKKSPHSLAASEYGGSDLLVQFLKQQTSDDYVDFWLESGEYRWTRTKPGRK 153

  Fly   555 IKEAIQKIWQEFLAPEAPCPVNVDSKSVELAREAVNSPSGP-NRWCFDVAASHVYHLMKSDSYSR 618
            .....|:|:.:|:..|.|      .|...|.:....|..|| .|..|..|.::|......|||.:
 Worm   154 RDIEAQRIYDKFVYGECP------RKIAHLEKMCFVSRQGPTGRDVFICAQAYVGTNFPKDSYKK 212

  Fly   619 YLRSDMYKDYL 629
            :|:..:|.:.|
 Worm   213 FLQDPIYLNLL 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_523380.2 DEP_RGS7-like 222..309 CDD:239897
RGS_DHEX 306..407 CDD:375589
GGL 432..493 CDD:128520
RGS_R7-like 504..627 CDD:188660 30/128 (23%)
rgs-9NP_508350.1 RGS 106..222 CDD:214613 29/121 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.