DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and Grid2ip

DIOPT Version :9

Sequence 1:NP_001245722.1 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001152793.1 Gene:Grid2ip / 170935 MGIID:2176213 Length:1203 Species:Mus musculus


Alignment Length:200 Identity:48/200 - (24%)
Similarity:66/200 - (33%) Gaps:46/200 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AKTDCTSSNSSDPLAV--AIPEPQSATAVVGGG-------------AGGAAPGTATPSPTPLANG 72
            |.|:..||...:|.:.  ..||||..:::....             :....||.....|.||..|
Mouse   461 AMTEPESSLDLEPESTPEPTPEPQPRSSLRASSMCRRSLRSQGLETSLSCGPGDCPEMPLPLIPG 525

  Fly    73 ---SNNGTGSSVSPAATGTGAVATA------ASAPAAAGTTS---ASPPASNPTTASTSTASVVG 125
               :.:||....:|......||...      :|.....||.|   ||||          ..|:||
Mouse   526 ERQAGDGTSLPETPNPKMMSAVYAELESRLNSSFKGKIGTMSKSRASPP----------VPSLVG 580

  Fly   126 AKTAAATTTSSSSATSSSTAAAGSKQSGSSGGLLTVSGNHHHHHHA-------HPQQSAAGQSAA 183
              |:...|.|..|..|.....:.......||||.:.|.:..|.:.:       .||.......|.
Mouse   581 --TSGPRTLSGVSWPSDRLLPSPCYDPLCSGGLASPSSSESHPYASLDSSRAPSPQPGLGSIHAD 643

  Fly   184 QPPQP 188
            .||.|
Mouse   644 SPPSP 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_001245722.1 DEP_RGS7-like 222..309 CDD:239897
GGL 432..493 CDD:128520
RGS_R7-like 504..627 CDD:188660
Grid2ipNP_001152793.1 PDZ_signaling 9..69 CDD:238492
HN_L-delphilin-R1_like 122..201 CDD:259820
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 215..270
PDZ_signaling 269..342 CDD:238492
HN_L-delphilin-R2_like 378..457 CDD:259821
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 466..541 16/74 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 563..586 11/34 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 611..656 8/37 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 710..821
FH2 812..1180 CDD:280362
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.