DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and Dhit

DIOPT Version :10

Sequence 1:NP_523380.2 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_061519473.1 Gene:Dhit / 1269979 VectorBaseID:AGAMI1_012508 Length:240 Species:Anopheles gambiae


Alignment Length:145 Identity:47/145 - (32%)
Similarity:78/145 - (53%) Gaps:10/145 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 QTDSTEMWDTEKNSKEVPVRRVKRWAFSLRELLNDAIGREQFTKFLEKEYSGENLKFWESVQEMK 548
            |..|..::|.|:.:.|    .::.|..|..:|:....||:.|.:||..|||.||:.||.:.:|:|
Mosquito    83 QASSDTLFDGEQPTLE----EIRSWGKSFDKLMRSPSGRKAFREFLRCEYSEENILFWLACEELK 143

  Fly   549 ALPQSE-IKEAIQKIWQEFLAPEAPCPVNVDSKSVELAREAVN-SPSGPNRWCFDVAASHVYHLM 611
            .....| |:|..:.|::::::..:|..|::||:    .||.|| :...|....||.|...:|.||
Mosquito   144 KETNPEAIEEKARFIYEDYISILSPKEVSLDSR----VREIVNRNMVEPTPHTFDEAQLQIYTLM 204

  Fly   612 KSDSYSRYLRSDMYK 626
            ..|||.|::.|..:|
Mosquito   205 HRDSYPRFINSPQFK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_523380.2 DEP_RGS7-like 222..309 CDD:239897
RGS_DHEX 306..407 CDD:375589
GGL 432..493 CDD:128520 2/8 (25%)
RGS_R7-like 504..627 CDD:188660 42/125 (34%)
DhitXP_061519473.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.