DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and Axin2

DIOPT Version :9

Sequence 1:NP_001245722.1 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_056547.3 Gene:Axin2 / 12006 MGIID:1270862 Length:840 Species:Mus musculus


Alignment Length:179 Identity:39/179 - (21%)
Similarity:73/179 - (40%) Gaps:35/179 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   475 TSPELPNPWQTDSTEMWDTEKNSKE------------VPVRRVKRWAFSLRELLNDAIGREQFTK 527
            |.|..|:..:..||:......|::.            .|...:.||..||..||.|..|...|..
Mouse    33 TPPCQPSVGKVQSTKPMPVSSNARRNEDGLGEPEGRASPDSPL
TRWTKSLHSLLGDQDGAYLFRT 97

  Fly   528 FLEKEYSGENLKFWESVQEMKALPQSEIK--EAIQKIWQEFLAPEAPCPVNVDSKSVE------- 583
            |||:|...:.|.||.:....:.:...:.|  ...:.|::.::...     :|.||.::       
Mouse    98 FLEREKCVDTLDFWFACNGFRQMNLKDTKTLRVAKAIYKRYIENN-----SVVSKQLKPATKTYI 157

  Fly   584 ---LAREAVNSPSGPNRWCFDVAASHVYHLMKSDSYSRYLRSDMYKDYL 629
               :.::.:.|.      .||.|.:.:..:|:.::|..:|.||:|.:|:
Mouse   158 RDGIKKQQIGSV------MFDQAQTEIQAVMEENAYQVFLTSDIYLEYV 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_001245722.1 DEP_RGS7-like 222..309 CDD:239897
GGL 432..493 CDD:128520 5/17 (29%)
RGS_R7-like 504..627 CDD:188660 31/134 (23%)
Axin2NP_056547.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..75 7/41 (17%)
AXIN1_TNKS_BD 10..73 CDD:374700 7/39 (18%)
Tankyrase-binding motif 21..30
RGS_Axin 82..198 CDD:188662 28/126 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..363
Interaction with GSK3B. /evidence=ECO:0000250 327..413
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..435
Interaction with beta-catenin. /evidence=ECO:0000250 413..478
Axin_b-cat_bind 432..467 CDD:370146
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 447..485
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 572..614
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 715..745
DAX 758..840 CDD:197474
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.