DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and rgs8

DIOPT Version :9

Sequence 1:NP_001245722.1 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_002937412.1 Gene:rgs8 / 100488999 XenbaseID:XB-GENE-990044 Length:216 Species:Xenopus tropicalis


Alignment Length:229 Identity:67/229 - (29%)
Similarity:106/229 - (46%) Gaps:50/229 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 GGSSHGTGS----AGASLAKNPVEQLTRIIALRKQKLERRTIKVSKAAEALVAYYDQYNEFDYFI 474
            ||  ||||.    .|::|.:      :|.|......|.:::              |.:::|    
 Frog    27 GG--HGTGKPARPCGSNLGR------SRGIRTHLSCLSQKS--------------DSFSDF---- 65

  Fly   475 TSPELPNPWQTDSTEMWDTEKNS---KEVPVRRVKRWAFSLRELLNDAIGREQFTKFLEKEYSGE 536
                         |.:....|:|   |.:.....:|||.|...||:...||..|..||:.|:|.|
 Frog    66 -------------TSLQYDSKHSQALKRLTPDEARRWARSFDLLLSHKYGRTMFRAFLQTEFSEE 117

  Fly   537 NLKFWESVQE-MKALPQSEIKEAIQKIWQEFLAPEAPCPVNVDSKSVELAREAVNSPSGPNRWCF 600
            ||:||.:.:| .|....:::......|:|||:..:||..||:|..:.||.:..:..|:   ..||
 Frog   118 NLEFWVACEEYRKTRSLNKLPAKAHHIFQEFIDVQAPREVNLDYPTRELTKRNLLHPT---LSCF 179

  Fly   601 DVAASHVYHLMKSDSYSRYLRSDMYKDYLNCSRK 634
            |:|...::.||:.|||.|:|||.||.|.|:.::|
 Frog   180 DLAQLRIHSLMERDSYPRFLRSKMYNDLLSHTQK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_001245722.1 DEP_RGS7-like 222..309 CDD:239897
GGL 432..493 CDD:128520 6/60 (10%)
RGS_R7-like 504..627 CDD:188660 47/123 (38%)
rgs8XP_002937412.1 RGS 82..206 CDD:383028 47/126 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.