DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and rgs13

DIOPT Version :9

Sequence 1:NP_001245722.1 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_002939125.2 Gene:rgs13 / 100486196 XenbaseID:XB-GENE-992598 Length:159 Species:Xenopus tropicalis


Alignment Length:146 Identity:39/146 - (26%)
Similarity:81/146 - (55%) Gaps:6/146 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   493 TEKNSKEVPVRRVKRWAFSLRELLNDAIGREQFTKFLEKEYSGENLKFWESVQEMKALPQSEIKE 557
            |:|||..:.:....:||.|.:::::...|...:..:|:.|:|.||::||.:.:..|.: .|..:.
 Frog    18 TKKNSLHISLEETLQWAESFQKMMSTQYGPAVYAAYLKTEFSDENIEFWFACERYKNI-TSRWRR 81

  Fly   558 AI--QKIWQEFLAPEAPCPVNVDSKSVELAREAVNSPSGPNRWCFDVAASHVYHLMKSDSYSRYL 620
            .:  :|:::.::.|.:|..:|:||.:.|...:.:..|:..:   ||.|...|...|:.|||.|:|
 Frog    82 TLKAKKLYKTYIKPNSPREINIDSPTREALEKEIQQPTPKS---FDEAQIIVLRHMERDSYPRFL 143

  Fly   621 RSDMYKDYLNCSRKKI 636
            .|::|::.::....||
 Frog   144 ASNVYQNIVSNLHDKI 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_001245722.1 DEP_RGS7-like 222..309 CDD:239897
GGL 432..493 CDD:128520 39/146 (27%)
RGS_R7-like 504..627 CDD:188660 33/124 (27%)
rgs13XP_002939125.2 RGS 37..150 CDD:383028 30/116 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.