DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and axin2

DIOPT Version :9

Sequence 1:NP_001245722.1 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_002935041.1 Gene:axin2 / 100380149 XenbaseID:XB-GENE-6449828 Length:707 Species:Xenopus tropicalis


Alignment Length:174 Identity:43/174 - (24%)
Similarity:75/174 - (43%) Gaps:23/174 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   475 TSPELPNPWQTDSTEMWDTEK--------NSKEVPVR----------RVKRWAFSLRELLNDAIG 521
            ||...|.|.|  .|:.:.:||        ..||..:|          |..||..||..||:|..|
 Frog    20 TSLRPPVPGQ--ETKNYKSEKFTMDSQHLRHKEDYIREAEGCVANDSRFSRWGRSLNLLLDDQDG 82

  Fly   522 REQFTKFLEKEYSGENLKFWESVQEMKALPQSEIK--EAIQKIWQEFLAPEAPCPVNVDSKSVEL 584
            ...|..:||.|...:.|.||.:....:|:...|.|  :..:.|::.::...:.....:...:...
 Frog    83 ATLFRMYLEGEGLVDLLSFWFACNGFRAMDPLEPKTSKTAKAIYRWYVQNSSAVSCRLKPSTRTQ 147

  Fly   585 AREAVNSPSGPNRWCFDVAASHVYHLMKSDSYSRYLRSDMYKDY 628
            .:|.|.:.. .|:..||.|...:...|:.::::.:|:||:.|:|
 Frog   148 VKECVKNQQ-LNKTVFDQAQQEIQRAMEQEAFTSFLQSDICKEY 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_001245722.1 DEP_RGS7-like 222..309 CDD:239897
GGL 432..493 CDD:128520 6/17 (35%)
RGS_R7-like 504..627 CDD:188660 30/124 (24%)
axin2XP_002935041.1 RGS_Axin 73..189 CDD:188662 26/116 (22%)
Axin_b-cat_bind 383..426 CDD:370146
DIX 630..702 CDD:366298
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.