DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and Rgs21

DIOPT Version :9

Sequence 1:NP_001245722.1 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001273951.1 Gene:Rgs21 / 100361166 RGDID:2320695 Length:152 Species:Rattus norvegicus


Alignment Length:134 Identity:43/134 - (32%)
Similarity:76/134 - (56%) Gaps:10/134 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   501 PVRRVKRWAFSLRELLNDAIGREQFTKFLEKEYSGENLKFWESVQEMKALPQSEIKEAI----QK 561
            |......|:.::..||.:..|.:.|..||:.|:|.||::||.:.::.|   ::|.:|.|    :.
  Rat    11 PTTETLAWSENMDSLLANQAGLDAFRTFLKSEFSEENVEFWLACEDFK---KTECREKIATKAKM 72

  Fly   562 IWQEFLAPEAPCPVNVDSKSVELAREAVNSPSGPNRWCFDVAASHVYHLMKSDSYSRYLRSDMYK 626
            |:.||:..:||..:|:|..:.:|....:..|: |.  |||.|...:|.||..||:.|:|:|::||
  Rat    73 IYSEFIVADAPKEINIDFSTRDLISRNIAEPT-PK--CFDEAQKLIYSLMAKDSFPRFLKSEIYK 134

  Fly   627 DYLN 630
            .::|
  Rat   135 KFIN 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_001245722.1 DEP_RGS7-like 222..309 CDD:239897
GGL 432..493 CDD:128520
RGS_R7-like 504..627 CDD:188660 40/126 (32%)
Rgs21NP_001273951.1 RGS 25..135 CDD:295367 39/115 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.