DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RSG7 and rgs14b

DIOPT Version :9

Sequence 1:NP_001245722.1 Gene:RSG7 / 32674 FlyBaseID:FBgn0024941 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_017208541.1 Gene:rgs14b / 100003648 ZFINID:ZDB-GENE-101006-2 Length:573 Species:Danio rerio


Alignment Length:142 Identity:47/142 - (33%)
Similarity:76/142 - (53%) Gaps:10/142 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   502 VRRVKRWAFSLRELLNDAIGREQFTKFLEKEYSGENLKFWESVQEMKALP--QSE-IKEAIQKIW 563
            |.:|..||.|...||.|.:|...||.||:.|.|.||:.||.:.::.:.:|  |:| :|.....|:
Zfish    54 VGQVASWAVSFERLLEDPVGVCYFTAFLKSEVSAENILFWSACEKFRKIPGHQTEQLKREALSIY 118

  Fly   564 QEFLAPEAPCPVNVDSKSVELAREAVNSPSGPNRWCFDVAASHVYHLMKSDSYSRYLRSDMYKDY 628
            ..||:..|..|:|:|.: |.:..:.|.:|...   .|..|...::.|||.|||:|::||.:|:  
Zfish   119 NTFLSSNATSPINIDDR-VRVEEKDVQNPHAD---IFQKAQQQIFKLMKFDSYTRFVRSQLYQ-- 177

  Fly   629 LNCSRKKIKSIP 640
             :|....::..|
Zfish   178 -SCMLANVEGRP 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RSG7NP_001245722.1 DEP_RGS7-like 222..309 CDD:239897
GGL 432..493 CDD:128520
RGS_R7-like 504..627 CDD:188660 44/125 (35%)
rgs14bXP_017208541.1 RGS_R12-like 64..178 CDD:188661 40/120 (33%)
UBQ 291..364 CDD:320785
TGS 365..432 CDD:330245
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.