DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4829 and GGTLC1

DIOPT Version :9

Sequence 1:NP_728030.2 Gene:CG4829 / 32672 FlyBaseID:FBgn0030796 Length:822 Species:Drosophila melanogaster
Sequence 2:XP_005260920.1 Gene:GGTLC1 / 92086 HGNCID:16437 Length:252 Species:Homo sapiens


Alignment Length:257 Identity:91/257 - (35%)
Similarity:134/257 - (52%) Gaps:35/257 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   596 LNSPDFGDQNRAKINDSHVLPDAQAYGANFAAIEDLDGTSNLVVLAPNGDAVSVTSSINSYFGSG 660
            :.|..|..|.||:|:|....| ...|...|...:| .||::|.|:|.:|.|||.||:||.||||.
Human     1 MTSEFFSAQLRAQISDDTTHP-ISYYKPEFYMPDD-GGTAHLSVVAEDGSAVSATSTINLYFGSK 63

  Fly   661 LIGPRTGIVLNNGMNDFAVKN--NIFALPQSQSNKIEAHKRAMSSQSPILLADKDGNMKMVIGAA 723
            :..|.:||:|||.|:||:..:  |.|.:|.|.:|.|:..|:.:||..|.::..:||.::||:|||
Human    64 VRSPVSGILLNNEMDDFSSTSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAA 128

  Fly   724 GGSKIIPAVVEVAANV---------------------------LWFGKDLRQAVDAPRFYHQLMP 761
            ||::|..|...|....                           ||||.|::.||:.||.::||:|
Human   129 GGTQITMATALVCVTPFLPGRAHPAQPPSHADHTPMPQAIIYNLWFGYDVKWAVEEPRLHNQLLP 193

  Fly   762 DVLEYEEDGFTESLLQLLTKRGH-KLKSISVKTGSVVTAISRNATAIYANADYRKRGGVAGF 822
            :|...|.:...|....|.|:..| ::.|..:   :||.||.|.|....|.:|.||.|..||:
Human   194 NVTTVERNIDQEVTAALETRHHHTQITSTFI---AVVQAIVRMAGGWAAASDSRKGGEPAGY 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4829NP_728030.2 G_glu_transpept 306..817 CDD:279371 88/250 (35%)
GGTLC1XP_005260920.1 G_glu_transpept <1..247 CDD:302793 88/250 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0405
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1419292at2759
OrthoFinder 1 1.000 - - FOG0000229
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.