DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4829 and LOC110439993

DIOPT Version :9

Sequence 1:NP_728030.2 Gene:CG4829 / 32672 FlyBaseID:FBgn0030796 Length:822 Species:Drosophila melanogaster
Sequence 2:XP_021333876.1 Gene:LOC110439993 / 110439993 -ID:- Length:133 Species:Danio rerio


Alignment Length:146 Identity:57/146 - (39%)
Similarity:77/146 - (52%) Gaps:21/146 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 LNLGITSTAT-TPSDDVLPNVAASTAATTAAPPTWLADQIKIDTSEQYNSILGVYQHGAVSSDNL 297
            |.|.:|..:| |.:...||:|..:|...|                    .|:...:..||::|..
Zfish     3 LFLTLTQRSTVTHTRRSLPSVKLNTPIMT--------------------PIVNCNEKAAVAADAE 47

  Fly   298 ECSKIGSGILQKNGSAVDAAIAALLCNGLLTLQSMGIGGGHLMNVYNRKERHATAIDAREVAPYE 362
            .|||||..||.:||||||||||||||..::..||||||||.:..:||........|:|||.||..
Zfish    48 ICSKIGRDILGRNGSAVDAAIAALLCVSVINPQSMGIGGGSVFTIYNAINGTVEIINARETAPMS 112

  Fly   363 ATEDMFAQQPENSDKG 378
            ||.:||.::|:..:.|
Zfish   113 ATANMFDKEPQKENPG 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4829NP_728030.2 G_glu_transpept 306..817 CDD:279371 38/73 (52%)
LOC110439993XP_021333876.1 G_glu_transpept 55..>129 CDD:327525 38/74 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D176986at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.