DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk28 and Gr59e

DIOPT Version :9

Sequence 1:NP_573169.2 Gene:ppk28 / 32671 FlyBaseID:FBgn0030795 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster


Alignment Length:263 Identity:56/263 - (21%)
Similarity:87/263 - (33%) Gaps:84/263 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LVVILSVFFISNVYVKWSASPI-----IISTSAKQKLTSNMPFPAITICNLNQALLSKVDRIGRT 133
            |..:.|:|.:  :|: |:.|.:     .:.....:||...|.||.      |.|.::.:      
  Fly    31 LHTLWSLFLL--MYI-WTGSIVKCLEFTVEIPTIEKLLYLMEFPG------NMATIAIL------ 80

  Fly   134 STNFSLLMGLCDQGGDTTISYIGTWKYFKAILVDVAQPCEKMLLYCSFGSREEDCSWLFTSILTD 198
             ..:::|......|.:..|..|.|....||          |.|:|...|.|   ...|..:.|..
  Fly    81 -VYYAVLNRPLAHGAELQIERIITGLKGKA----------KRLVYKRHGQR---TLHLMATTLVF 131

  Fly   199 DGLCCNFNALHPSYLIRNYSDDVRLETAHPNTRYELIDWTPEKGYARNLPEFYFPRTSGGTGIRM 263
            .|||...:.:       ||  |....|.          |:....|  |||           |:.|
  Fly   132 HGLCVLVDVV-------NY--DFEFWTT----------WSSNSVY--NLP-----------GLMM 164

  Fly   264 GLTVVLNASIAEY---------YCTKSMSVGFKVLVHNPAELPKV-----SNYGFVVTAGREARI 314
            .|.|:..|....:         .|.|.:    |:|...|....|:     |.:..:|.||..:.:
  Fly   165 SLGVLQYAQPVHFLWLVMDQMRMCLKEL----KLLQRPPQGSTKLDACYESAFAVLVDAGGGSAL 225

  Fly   315 PIE 317
            .||
  Fly   226 MIE 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk28NP_573169.2 ASC 43..509 CDD:279230 56/263 (21%)
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 56/263 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.