DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk28 and Y57G11C.44

DIOPT Version :9

Sequence 1:NP_573169.2 Gene:ppk28 / 32671 FlyBaseID:FBgn0030795 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001255829.1 Gene:Y57G11C.44 / 3565567 WormBaseID:WBGene00013333 Length:155 Species:Caenorhabditis elegans


Alignment Length:144 Identity:35/144 - (24%)
Similarity:70/144 - (48%) Gaps:21/144 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTESRRRQSG----------SSG----CKKDSESDD--DENTICSRAAIKRSVVY-YLKNSTLHG 51
            ::|.|:|:|.          |.|    ..||.|:|.  |:....:|.:..:|.|: :..:.:.||
 Worm     1 MSEVRQRKSSIIDSDLDFSDSDGEFKEIIKDIENDQWKDKPVDETRWSKTKSAVHEWGLSCSWHG 65

  Fly    52 LKYIAEESITIPERIFFGLAFVLVVILSVFFISNVYVKWSASPIIISTSAKQKLTSNMPFPAITI 116
            :.::| :|::.|..:.:....::..:|.|:.|:....::.:...:::.:... :.||  ||:||.
 Worm    66 IPHMA-QSLSWPTILLWTTLLIISAVLFVYLITVTVRQYFSFQKLVNLNIGM-VESN--FPSITF 126

  Fly   117 CNLNQALLSKVDRI 130
            ||.|...||.|..|
 Worm   127 CNTNPYKLSAVRAI 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk28NP_573169.2 ASC 43..509 CDD:279230 21/88 (24%)
Y57G11C.44NP_001255829.1 ASC 60..>142 CDD:279230 21/85 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162354
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.