DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4789 and AT5G09910

DIOPT Version :9

Sequence 1:NP_573166.1 Gene:CG4789 / 32668 FlyBaseID:FBgn0030792 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001318521.1 Gene:AT5G09910 / 830852 AraportID:AT5G09910 Length:333 Species:Arabidopsis thaliana


Alignment Length:202 Identity:63/202 - (31%)
Similarity:93/202 - (46%) Gaps:55/202 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RVRIVVVGDSGVGKTSLTHLITHNEALIRPGWTVGCNIQVKMHPFREGTA--------RECPYFV 62
            ::|::|||||||||:||.|||....:::||..|:||.:.||...:....:        .|..:||
plant    22 QIRVLVVGDSGVGKSSLVHLIVKGSSIVRPSQTIGCTVGVKHLTYASPASSSSIIKGDSERDFFV 86

  Fly    63 ELFDVGGSLNHKNTRSVFYAGIDGIILVHDLTNAKSQRQLIDWLYEIVNKEGKDTNKSNGASMPP 127
            ||:||.|...:|:.||:||:.|:|:|.||||:...::..|..|..|:              |:..
plant    87 ELWDVSGHERYKDCRSLFYSQINGVIFVHDLSQRTTKTNLQKWAGEV--------------SVTG 137

  Fly   128 SPPSPLSSFSTDNLGTDGHILFDMEEFLGATQTPILVMGTKLD-------------LLDEKRHPK 179
            ...:||||...                 |....|.:|:|.|.|             |:|..||  
plant   138 EFSAPLSSGGP-----------------GGLPVPYIVIGNKADIAAKGGTNGSSGNLVDAARH-- 183

  Fly   180 MGVKKPG 186
             .|:|.|
plant   184 -WVEKQG 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4789NP_573166.1 P-loop_NTPase 7..228 CDD:304359 63/201 (31%)
AT5G09910NP_001318521.1 PLN00023 2..333 CDD:177661 63/202 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 92 1.000 Domainoid score I2589
eggNOG 1 0.900 - - E1_2CN0E
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H12171
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1269342at2759
OrthoFinder 1 1.000 - - FOG0005865
OrthoInspector 1 1.000 - - otm2539
orthoMCL 1 0.900 - - OOG6_105341
Panther 1 1.100 - - O PTHR24073
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4259
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.870

Return to query results.
Submit another query.