DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4789 and Rab18

DIOPT Version :9

Sequence 1:NP_573166.1 Gene:CG4789 / 32668 FlyBaseID:FBgn0030792 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster


Alignment Length:224 Identity:56/224 - (25%)
Similarity:88/224 - (39%) Gaps:70/224 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VRIVVVGDSGVGKTSLTHLITHNEALIRPGWTVGCNIQVKMHPFREGTARECPYFVELFDVGGSL 71
            ::::|:|:|||||:||......|:.......|:|.:.:.|:... :|    ..|.|.|:|..|:.
  Fly     6 IKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQV-DG----IDYKVALWDTAGAE 65

  Fly    72 NHKNTRSVFYAGIDGIILVHDLTNAKSQRQLIDWLYEIVNKEGKDTNKSNGASMPPSPPSPLSSF 136
            ..::....||....|.|||:|:|:..|..:|..||.|                        |.|:
  Fly    66 RFRSLTPSFYRKALGAILVYDITSRDSLVKLETWLAE------------------------LDSY 106

  Fly   137 STDNLGTDGHILFDMEEFLGATQTPILVMGTKLDLLDEKRHPKMGVKKPGGIADKCGAEEIWLNC 201
            | ||                 ....|:|:|.|   :||:|           :.|:   ||.....
  Fly   107 S-DN-----------------PNIAIIVVGNK---IDEER-----------VVDR---EEGRKFA 136

  Fly   202 RNSRSLAAGTTDAVKLSRF----FDRVIE 226
            |..|:|...|  :.|..:|    |..|:|
  Fly   137 RKHRALFIET--SAKCDQFVSDVFKDVVE 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4789NP_573166.1 P-loop_NTPase 7..228 CDD:304359 56/224 (25%)
Rab18NP_524744.2 RAB 6..166 CDD:197555 56/224 (25%)
Rab18 6..165 CDD:206656 56/224 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454536
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.