DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4789 and Rab7

DIOPT Version :9

Sequence 1:NP_573166.1 Gene:CG4789 / 32668 FlyBaseID:FBgn0030792 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster


Alignment Length:239 Identity:48/239 - (20%)
Similarity:92/239 - (38%) Gaps:73/239 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VRIVVVGDSGVGKTSLTHLITHNEALIRPGWTVGCNIQVKMHPFREGTARECPYFVELFDVGGSL 71
            ::::::|||.||||||.:...:.....:...|:|.:...|     |....:....::::|..|..
  Fly     9 LKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTK-----EVVVNDRVVTMQIWDTAGQE 68

  Fly    72 NHKNTRSVFYAGIDGIILVHDLTNAKSQRQLIDWLYEIVNKEGKDTNKSNGASMPPSPPSPLSSF 136
            ..::....||.|.|..:||:|:|...|.:.|..|..|.:              :..||..|    
  Fly    69 RFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFL--------------IQASPRDP---- 115

  Fly   137 STDNLGTDGHILFDMEEFLGATQTPILVMGTKLDLLDEKRHPKMGVKKPGGIADKCGAEEIWLNC 201
                           :.|      |.:|:|.|:| ||.:   ::..::         |:: |  |
  Fly   116 ---------------DHF------PFVVLGNKVD-LDNR---QVSTRR---------AQQ-W--C 143

  Fly   202 RNSRSLAAGTTDAVKLSRFFDRVIENRKALRAALAFGVSSSNAV 245
            ::...:....|.|             ::.:...:||.|.:.||:
  Fly   144 QSKNDIPYYETSA-------------KEGINVEMAFQVIAKNAL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4789NP_573166.1 P-loop_NTPase 7..228 CDD:304359 43/220 (20%)
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 48/239 (20%)
RAB 9..174 CDD:197555 47/237 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454527
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.