DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4789 and rabl3

DIOPT Version :9

Sequence 1:NP_573166.1 Gene:CG4789 / 32668 FlyBaseID:FBgn0030792 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_991296.1 Gene:rabl3 / 403048 ZFINID:ZDB-GENE-040808-11 Length:233 Species:Danio rerio


Alignment Length:259 Identity:107/259 - (41%)
Similarity:151/259 - (58%) Gaps:40/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAMNNRVRIVVVGDSGVGKTSLTHLITHNEALIRPGWTVGCNIQVKMHPFREGTARECPYFVELF 65
            ||..:||:::|:|||||||:||.||:..|:.|..|.|||||::.|::|.:||||..|..:::||:
Zfish     1 MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYREGTPEEKAFYIELW 65

  Fly    66 DVGGSLNH----KNTRSVFYAGIDGIILVHDLTNAKSQRQLIDWLYEIVNKEGKDTN--KSNGAS 124
            |||||:..    |:||:|||..::||||||||||.||.:.|..|..|.::|:...|.  .|||. 
Zfish    66 DVGGSVGSASSVKSTRAVFYNSVNGIILVHDLTNKKSSQNLYRWSLEALSKDSSPTGIIVSNGD- 129

  Fly   125 MPPSPPSPLSSFSTDNLGTDGHILFDMEEFLGATQTPILVMGTKLDLLDEKRHPKMGVKKPGGIA 189
                                    :|.|:| .....|:|::|||.|.:.|.:...: :.:...::
Zfish   130 ------------------------YDREQF-AENAVPLLLIGTKFDQIPENKRNDV-LTRTAFLS 168

  Fly   190 DKCGAEEIWLNCRNSRSLAAGTTDAVKLSRFFDRVIENRKALRAALAFGVSSSNAVSPPDRRRF 253
            :...||||.|:|.|.|.||||:::|||||||||:|||.|...|       ..|...|..|||||
Zfish   169 EDFNAEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIEKRYFTR-------DPSQMQSFTDRRRF 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4789NP_573166.1 P-loop_NTPase 7..228 CDD:304359 95/226 (42%)
rabl3NP_991296.1 Small GTPase-like 1..233 107/259 (41%)
RabL3 7..210 CDD:206689 96/229 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 124 1.000 Domainoid score I5506
eggNOG 1 0.900 - - E1_2CN0E
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12171
Inparanoid 1 1.050 179 1.000 Inparanoid score I4003
OMA 1 1.010 - - QHG49110
OrthoDB 1 1.010 - - D1269342at2759
OrthoFinder 1 1.000 - - FOG0005865
OrthoInspector 1 1.000 - - oto41191
orthoMCL 1 0.900 - - OOG6_105341
Panther 1 1.100 - - LDO PTHR24073
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3062
SonicParanoid 1 1.000 - - X4259
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.