DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4789 and RabX6

DIOPT Version :9

Sequence 1:NP_573166.1 Gene:CG4789 / 32668 FlyBaseID:FBgn0030792 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster


Alignment Length:207 Identity:49/207 - (23%)
Similarity:72/207 - (34%) Gaps:67/207 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIVVVGDSGVGKTSLTHLITHNEALI---RPGWTVGCNIQVKMHPFREGTARECPYFVELFDVGG 69
            ::::.||.||||:||......|..:.   |.. |:|.:     |..||.:..|....::|:|.||
  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKS-TLGLD-----HIDREYSVNEKQIKLQLWDTGG 68

  Fly    70 SLNHKNTRSVFYAGIDGIILVHDLTNAKSQRQLIDWLYEIVNKEGKDTNKSNGASMPPSPPSPLS 134
            .....:..|.:|...:|.|||..|.||.|...|...|.:||..                      
  Fly    69 MERVASVTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTY---------------------- 111

  Fly   135 SFSTDNLGTDGHILFDMEEFLGATQTPILVMGTKLDLLDEKRHPKMGVKKPGGIADKCGAEEIWL 199
                                  |....|.:.|.|.||  :.|.|:        ::|    ||:..
  Fly   112 ----------------------AENAKIFICGNKSDL--DGREPE--------VSD----EEVEA 140

  Fly   200 NCRNSRSLAAGT 211
            .|....||.:.|
  Fly   141 FCEQCHSLISAT 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4789NP_573166.1 P-loop_NTPase 7..228 CDD:304359 49/207 (24%)
RabX6NP_001261219.1 RAB 10..176 CDD:197555 49/207 (24%)
Rab 10..172 CDD:206640 49/207 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.