DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4789 and Rab3

DIOPT Version :9

Sequence 1:NP_573166.1 Gene:CG4789 / 32668 FlyBaseID:FBgn0030792 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster


Alignment Length:219 Identity:42/219 - (19%)
Similarity:88/219 - (40%) Gaps:61/219 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIVVVGDSGVGKTSLTHLITHNEALIRPGWTVGCNIQVKMHPFREGTARECPYFVELFDVGGSLN 72
            :::::|:|.|||||.......:........|||.:.:||. .||.....:    ::::|..|...
  Fly    23 KLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKT-VFRHDKRVK----LQIWDTAGQER 82

  Fly    73 HKNTRSVFYAGIDGIILVHDLTNAKSQRQLIDWLYEIVNKEGKDTNKSNGASMPPSPPSPLSSFS 137
            ::...:.:|.|..|.||::|:||..|...:.||:.:|                        .::|
  Fly    83 YRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQI------------------------KTYS 123

  Fly   138 TDNLGTDGHILFDMEEFLGATQTPILVMGTKLDLLDEKRHPKMGVKKPGGIADKCGAEEIWLNCR 202
            .||                   ..::::|.|.|:.|::   .:..::...:||:.|.|....:.:
  Fly   124 WDN-------------------AQVILVGNKCDMEDQR---VISFERGRQLADQLGVEFFETSAK 166

  Fly   203 NSRSLAAGTTDAVKLSRFFDRVIE 226
            .:          |.:...|:|:::
  Fly   167 EN----------VNVKAVFERLVD 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4789NP_573166.1 P-loop_NTPase 7..228 CDD:304359 42/219 (19%)
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 42/219 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454268
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.