DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4789 and Rab32

DIOPT Version :9

Sequence 1:NP_573166.1 Gene:CG4789 / 32668 FlyBaseID:FBgn0030792 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster


Alignment Length:125 Identity:29/125 - (23%)
Similarity:53/125 - (42%) Gaps:14/125 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIVVVGDSGVGKTSLTHLITHNEALIRPGWTVGCNIQVKMHPFREGTARECPYFVELFDVGGSLN 72
            :|:|:|:.|.||||......|.........|:|.:..:|:..:...|...    ::|:|:.|...
  Fly   485 KILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVR----LQLWDIAGQER 545

  Fly    73 HKNTRSVFYAGIDGIILVHDLTNAKSQRQLIDWLYEIVNKEGKDTNKSNGASMPPSPPSP 132
            ..|...|:|....|..:|.|:|.:.:        ::.|:|..:|.:..  ..:|...|.|
  Fly   546 FGNMTRVYYKEAVGAFIVFDVTRSGT--------FDCVSKWKEDLDSK--VQLPDGSPIP 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4789NP_573166.1 P-loop_NTPase 7..228 CDD:304359 29/125 (23%)
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 29/125 (23%)
RAB 484..652 CDD:197555 29/125 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454559
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.