DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4789 and Rab9

DIOPT Version :9

Sequence 1:NP_573166.1 Gene:CG4789 / 32668 FlyBaseID:FBgn0030792 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster


Alignment Length:214 Identity:44/214 - (20%)
Similarity:75/214 - (35%) Gaps:56/214 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VRIVVVGDSGVGKTSLTHLITHNEALIRPGWTVG---CNIQVKMHPFREGTARECPYFVELFDVG 68
            :::|::||.||||::|......|........|:|   .|..:.:...|        |.::::|..
  Fly    13 LKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGER--------YTLQIWDTA 69

  Fly    69 GSLNHKNTRSVFYAGIDGIILVHDLTNAKSQRQLIDWLYEIVNKEGKDTNKSNGASMPPSPPSPL 133
            |....:..|:.||.|.|..:|.:.|.:..|.:.|..|..|.:|....|.:|              
  Fly    70 GQERFRALRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADVDQDK-------------- 120

  Fly   134 SSFSTDNLGTDGHILFDMEEFLGATQTPILVMGTKLDLLDEKRHPKMGVKKPGGIADKCGAEEIW 198
                                      .|.:|:|.|.|:..:||.     .....:...|..:::.
  Fly   121 --------------------------FPFIVVGNKNDIPAQKRQ-----VSSDAVQQWCAEQKVA 154

  Fly   199 LNCRNSRSLAAGTTDAVKL 217
            .:...|...|...|||..|
  Fly   155 CHIETSSKAATNVTDAFVL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4789NP_573166.1 P-loop_NTPase 7..228 CDD:304359 44/214 (21%)
Rab9NP_609966.1 Rab9 8..178 CDD:206697 44/214 (21%)
Ras 14..177 CDD:278499 44/213 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454558
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.