DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4789 and Rab21

DIOPT Version :9

Sequence 1:NP_573166.1 Gene:CG4789 / 32668 FlyBaseID:FBgn0030792 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster


Alignment Length:210 Identity:34/210 - (16%)
Similarity:71/210 - (33%) Gaps:85/210 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIVVVGDSGVGKTSLT-----------HLITHNEALIRPGWTVGCNIQVKMHPFREGTARECPYF 61
            :.|::|:..||||||.           ||.|...:.:.           :.....:|...:    
  Fly    15 KAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVS-----------RKMSLEDGRRAQ---- 64

  Fly    62 VELFDVGGSLNHKNTRSVFYAGIDGIILVHDLTNAKSQRQLIDWLYEIVNKEGKDTNKSNGASMP 126
            :.::|..|.........::|.|.||.:||:|:|:..|.:::..|:.|:....|            
  Fly    65 LNIWDTAGQERFHALGPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRG------------ 117

  Fly   127 PSPPSPLSSFSTDNLGTDGHILFDMEEFLGATQTPILVMGTKLDLLDEK---------------- 175
                                           |:..::::|.|.||.:::                
  Fly   118 -------------------------------TEIALIIVGNKTDLEEQRAVTHDEALQYARTVGA 151

  Fly   176 RHPKMGVKKPGGIAD 190
            ::.:...|:..|:|:
  Fly   152 QYVETSAKENEGVAE 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4789NP_573166.1 P-loop_NTPase 7..228 CDD:304359 34/210 (16%)
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 34/210 (16%)
Ras 15..177 CDD:278499 34/210 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454544
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.