DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4789 and Rab5

DIOPT Version :9

Sequence 1:NP_573166.1 Gene:CG4789 / 32668 FlyBaseID:FBgn0030792 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster


Alignment Length:113 Identity:24/113 - (21%)
Similarity:51/113 - (45%) Gaps:27/113 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIVVVGDSGVGKTSLTHLITHNEALIRPGWTVGCNIQVKMHPFREGT-----------ARECPYF 61
            ::|::|:|.|||:||         ::|       .::.:.|.::|.|           ..:....
  Fly    31 KLVLLGESAVGKSSL---------VLR-------FVKGQFHEYQESTIGAAFLTQTICIEDTVVK 79

  Fly    62 VELFDVGGSLNHKNTRSVFYAGIDGIILVHDLTNAKSQRQLIDWLYEI 109
            .|::|..|...:.:...::|.|....|:|:|:.|..|.::...|:.|:
  Fly    80 FEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKEL 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4789NP_573166.1 P-loop_NTPase 7..228 CDD:304359 24/113 (21%)
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 24/113 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454242
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.