DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4789 and Rab35

DIOPT Version :9

Sequence 1:NP_573166.1 Gene:CG4789 / 32668 FlyBaseID:FBgn0030792 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster


Alignment Length:223 Identity:55/223 - (24%)
Similarity:92/223 - (41%) Gaps:59/223 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIVVVGDSGVGKTSLTHLITHNEALIRPGW--TVGCNIQVKMHPFREGTARECPYFVELFDVGGS 70
            :::::|||||||:||  ||..::......:  |:|.:.:::.... ||...:    ::::|..|.
  Fly    10 KLLIIGDSGVGKSSL--LIRFSDDTFSGSYITTIGVDFKIRTVDI-EGMRVK----LQIWDTAGQ 67

  Fly    71 LNHKNTRSVFYAGIDGIILVHDLTNAKSQRQLIDWLYEIVN-----KEGKDTNKSNGASMPP--- 127
            ...:...|.:|.|..|:|:|:|:||.:|...:..||.||.|     |:....||::......   
  Fly    68 ERFRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNCDVVKKVLVGNKNDDPDRKVVIT 132

  Fly   128 ------SPPSPLSSFST---DNLGTDGHILFDMEEFLGATQTPILVMGTKL---------DLLDE 174
                  :....:..|.|   ||:..:       ..||..|:.   |:..||         |.|..
  Fly   133 EDAQRFAKQMDIELFETSAKDNINVE-------NMFLSITRQ---VLDHKLRTSPNEQQKDTLHL 187

  Fly   175 KRHPKMGVKKPGGIADKCGAEEIWLNCR 202
            |.:||      |....||        ||
  Fly   188 KPNPK------GSKGGKC--------CR 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4789NP_573166.1 P-loop_NTPase 7..228 CDD:304359 55/223 (25%)
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 53/221 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454551
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.