DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4789 and Rab9E

DIOPT Version :9

Sequence 1:NP_573166.1 Gene:CG4789 / 32668 FlyBaseID:FBgn0030792 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_727438.1 Gene:Rab9E / 318148 FlyBaseID:FBgn0052673 Length:197 Species:Drosophila melanogaster


Alignment Length:115 Identity:31/115 - (26%)
Similarity:54/115 - (46%) Gaps:21/115 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NNRVRIVVVGDSGVGKTSLTHLITHNEALIRPGWTVGCNIQVKMHPFREGTARECPY-------- 60
            :|..:|:::||||||||.|....:.|:...|...|:|.:            .|||..        
  Fly     5 DNPFKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTLGMD------------RRECSVEFADWRMG 57

  Fly    61 -FVELFDVGGSLNHKNTRSVFYAGIDGIILVHDLTNAKSQRQLIDWLYEI 109
             .::::|.......|..::.......||:||:|:|::||.:.:..|:.||
  Fly    58 RMLQVWDTSDDERFKLLKATHCRSAHGILLVYDITSSKSFQNIDGWMKEI 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4789NP_573166.1 P-loop_NTPase 7..228 CDD:304359 30/112 (27%)
Rab9ENP_727438.1 RAB 8..171 CDD:197555 30/112 (27%)
Rab 8..167 CDD:206640 30/112 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454360
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.